RBPMS2 antibody (Middle Region)

Catalog No. ABIN633407

Product Details anti-RBPMS2 Antibody

Target: RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBPMS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBPMS2 antibody was raised against the middle region of RBPMS2

Purification: Affinity purified

Immunogen: RBPMS2 antibody was raised using the middle region of RBPMS2 corresponding to a region with amino acids MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBPMS2 Blocking Peptide, catalog no. 33R-6010, is also available for use as a blocking control in assays to test for specificity of this RBPMS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBPMS2

Target: RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))

Alternative Name: RBPMS2 (RBPMS2 Products)

Synonyms: hermes antibody, RBPMS antibody, 2400008B06Rik antibody, AI316523 antibody, RGD1561222 antibody, rbpms2 antibody, zgc:55559 antibody, zgc:77170 antibody, RNA binding protein with multiple splicing 2 L homeolog antibody, RNA binding protein with multiple splicing 2 antibody, RNA binding protein with multiple splicing 2b antibody, rbpms2.L antibody, RBPMS2 antibody, Rbpms2 antibody, rbpms2b antibody

Background: The function of RBPMS2 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 22 kDa (MW of target protein)