EIF2D antibody (Middle Region)
-
- Target See all EIF2D Antibodies
- EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF2D antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Ligatin antibody was raised against the middle region of LGTN
- Purification
- Affinity purified
- Immunogen
- Ligatin antibody was raised using the middle region of LGTN corresponding to a region with amino acids KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ
- Top Product
- Discover our top product EIF2D Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Ligatin Blocking Peptide, catalog no. 33R-4725, is also available for use as a blocking control in assays to test for specificity of this Ligatin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGTN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))
- Alternative Name
- Ligatin (EIF2D Products)
- Synonyms
- LGTN antibody, HCA56 antibody, D1Ertd5e antibody, Lgtn antibody, eukaryotic translation initiation factor 2D antibody, EIF2D antibody, Eif2d antibody
- Background
- LGTN is a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively.
- Molecular Weight
- 65 kDa (MW of target protein)
-