SF3A1 antibody (N-Term)

Catalog No. ABIN633401

Product Details anti-SF3A1 Antibody

Target: SF3A1 (Splicing Factor 3a, Subunit 1 (SF3A1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SF3A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SF3 A1 antibody was raised against the N terminal of SF3 1

Purification: Affinity purified

Immunogen: SF3 A1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF3A1 Blocking Peptide, catalog no. 33R-8124, is also available for use as a blocking control in assays to test for specificity of this SF3A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SF3A1

Target: SF3A1 (Splicing Factor 3a, Subunit 1 (SF3A1))

Alternative Name: SF3A1 (SF3A1 Products)

Synonyms: Dmel\\CG16941 antibody, SF3a1 antibody, SF3a120 antibody, DDBDRAFT_0168938 antibody, DDBDRAFT_0233180 antibody, DDB_0168938 antibody, DDB_0233180 antibody, 1200014H24Rik antibody, 5930416L09Rik antibody, AI159724 antibody, si:dz150f13.2 antibody, wu:fc38e01 antibody, wu:fc50a11 antibody, wu:fj37c05 antibody, zgc:65786 antibody, PRP21 antibody, PRPF21 antibody, SAP114 antibody, SF3A120 antibody, CG16941 gene product from transcript CG16941-RA antibody, SWAP/Surp domain-containing protein antibody, splicing factor 3a, subunit 1 antibody, splicing factor 3a subunit 1 antibody, CG16941 antibody, sf3a1 antibody, spl1 antibody, Sf3a1 antibody, SF3A1 antibody

Background: SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family, named for the SURP motifs that are thought to mediate RNA binding.

Molecular Weight: 89 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization