OLA1 antibody

Catalog No. ABIN633398

Product Details anti-OLA1 Antibody

Target: OLA1 (Obg-Like ATPase 1 (OLA1))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OLA1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GTPBP9 Blocking Peptide, catalog no. 33R-7451, is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OLA1

Target: OLA1 (Obg-Like ATPase 1 (OLA1))

Alternative Name: GTPBP9 (OLA1 Products)

Synonyms: MGC79585 antibody, PTD004 antibody, GTPBP9 antibody, DOC45 antibody, GBP45 antibody, GTBP9 antibody, 2510025G09Rik antibody, 2810405J23Rik antibody, 2810409H07Rik antibody, Gtpbp9 antibody, RGD1307982 antibody, fe36h01 antibody, wu:fc66b09 antibody, wu:fe36h01 antibody, wu:fk82a02 antibody, zgc:55768 antibody, zgc:85691 antibody, Obg-like ATPase 1 antibody, Obg like ATPase 1 antibody, Obg-like ATPase 1 L homeolog antibody, ola1 antibody, OLA1 antibody, Ola1 antibody, ola1.L antibody

Background: GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.

Molecular Weight: 44 kDa (MW of target protein)