U2AF1 antibody (N-Term)
-
- Target See all U2AF1 Antibodies
- U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1 (U2AF1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This U2AF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- U2 AF1 antibody was raised against the N terminal of U2 F1
- Purification
- Affinity purified
- Immunogen
- U2 AF1 antibody was raised using the N terminal of U2 F1 corresponding to a region with amino acids MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN
- Top Product
- Discover our top product U2AF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
U2AF1 Blocking Peptide, catalog no. 33R-5649, is also available for use as a blocking control in assays to test for specificity of this U2AF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of U0 F1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1 (U2AF1))
- Alternative Name
- U2AF1 (U2AF1 Products)
- Background
- This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site.
- Molecular Weight
- 28 kDa (MW of target protein)
-