C6orf201 antibody (N-Term)

Catalog No. ABIN633387

Product Details anti-C6orf201 Antibody

Target: C6orf201 (Chromosome 6 Open Reading Frame 201 (C6orf201))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C6orf201 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C6 ORF201 antibody was raised against the N terminal Of C6 rf201

Purification: Affinity purified

Immunogen: C6 ORF201 antibody was raised using the N terminal Of C6 rf201 corresponding to a region with amino acids PFGMGLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6ORF201 Blocking Peptide, catalog no. 33R-7072, is also available for use as a blocking control in assays to test for specificity of this C6ORF201 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF201 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C6orf201

Target: C6orf201 (Chromosome 6 Open Reading Frame 201 (C6orf201))

Alternative Name: C6ORF201 (C6orf201 Products)

Synonyms: dJ1013A10.5 antibody, chromosome 6 open reading frame 201 antibody, C6orf201 antibody

Background: The specific function of C6orf201 is not yet known.

Molecular Weight: 14 kDa (MW of target protein)