ANKRD42 antibody (N-Term)

Catalog No. ABIN633385

Product Details anti-ANKRD42 Antibody

Target: ANKRD42 (Ankyrin Repeat Domain 42 (ANKRD42))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD42 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ANKRD42 antibody was raised against the N terminal of ANKRD42

Purification: Affinity purified

Immunogen: ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD42 Blocking Peptide, catalog no. 33R-7191, is also available for use as a blocking control in assays to test for specificity of this ANKRD42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD42

Target: ANKRD42 (Ankyrin Repeat Domain 42 (ANKRD42))

Alternative Name: ANKRD42 (ANKRD42 Products)

Synonyms: SARP antibody, 4931426M20 antibody, 4933417L02Rik antibody, Ikbn antibody, RGD1310789 antibody, ANKRD42 antibody, DKFZp469H1622 antibody, ankyrin repeat domain 42 antibody, ankyrin repeat domain 42 L homeolog antibody, ANKRD42 antibody, Ankrd42 antibody, ankrd42.L antibody

Background: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 43 kDa (MW of target protein)