KHSRP antibody (Middle Region)
-
- Target See all KHSRP Antibodies
- KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KHSRP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KHSRP antibody was raised against the middle region of KHSRP
- Purification
- Affinity purified
- Immunogen
- KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG
- Top Product
- Discover our top product KHSRP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KHSRP Blocking Peptide, catalog no. 33R-9939, is also available for use as a blocking control in assays to test for specificity of this KHSRP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHSRP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))
- Alternative Name
- KHSRP (KHSRP Products)
- Synonyms
- FBP2 antibody, FUBP2 antibody, KSRP antibody, 6330409F21Rik antibody, Fbp2 antibody, Fubp2 antibody, Ksrp antibody, Marta1 antibody, KHSRP antibody, VgRBP71 antibody, fbp2 antibody, ksrp antibody, fubp2 antibody, fc94c12 antibody, wu:fb25b12 antibody, wu:fc10e10 antibody, wu:fc94c12 antibody, zgc:163038 antibody, khsrp-b antibody, KH-type splicing regulatory protein antibody, KH-type splicing regulatory protein L homeolog antibody, KH-type splicing regulatory protein S homeolog antibody, KHSRP antibody, Khsrp antibody, khsrp.L antibody, khsrp antibody, khsrp.S antibody
- Background
- KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).
- Molecular Weight
- 73 kDa (MW of target protein)
-