ENOX1 antibody (Middle Region)

Catalog No. ABIN633381

Product Details anti-ENOX1 Antibody

Target: ENOX1 (Ecto-NOX Disulfide-Thiol Exchanger 1 (ENOX1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ENOX1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ENOX1 antibody was raised against the middle region of ENOX1

Purification: Affinity purified

Immunogen: ENOX1 antibody was raised using the middle region of ENOX1 corresponding to a region with amino acids QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ENOX1 Blocking Peptide, catalog no. 33R-7696, is also available for use as a blocking control in assays to test for specificity of this ENOX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ENOX1

Target: ENOX1 (Ecto-NOX Disulfide-Thiol Exchanger 1 (ENOX1))

Alternative Name: ENOX1 (ENOX1 Products)

Synonyms: CNOX antibody, PIG38 antibody, bA64J21.1 antibody, cCNOX antibody, B230207J08 antibody, D230005D02Rik antibody, RGD1306118 antibody, ecto-NOX disulfide-thiol exchanger 1 S homeolog antibody, ecto-NOX disulfide-thiol exchanger 1 antibody, enox1.S antibody, ENOX1 antibody, Enox1 antibody

Background: Electron transport pathways are generally associated with mitochondrial membranes, but non-mitochondrial pathways are also biologically significant. Plasma membrane electron transport pathways are involved in functions as diverse as cellular defense, intracellular redox homeostasis, and control of cell growth and survival. Members of the ecto-NOX family, such as CNOX, or ENOX1, are involved in plasma membrane transport pathways. These enzymes exhibit both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity in series, with each activity cycling every 22 to 26 minutes.

Molecular Weight: 73 kDa (MW of target protein)