RG9MTD1 antibody

Catalog No. ABIN633378

Product Details anti-RG9MTD1 Antibody

Target: RG9MTD1 (RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RG9MTD1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RG9 MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RG9MTD1 Blocking Peptide, catalog no. 33R-6162, is also available for use as a blocking control in assays to test for specificity of this RG9MTD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RG9MTD1

Target: RG9MTD1 (RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1))

Alternative Name: RG9MTD1 (RG9MTD1 Products)

Synonyms: RG9MTD1 antibody, rg9mtd1 antibody, wu:fb53e06 antibody, zgc:103570 antibody, HNYA antibody, MRPP1 antibody, Rg9mtd1 antibody, 1300018J16Rik antibody, D16Ertd454e antibody, Rnmtd1 antibody, tRNA methyltransferase 10C, mitochondrial RNase P subunit antibody, tRNA methyltransferase 10C, mitochondrial RNase P subunit L homeolog antibody, tRNA methyltransferase 10C antibody, TRMT10C antibody, trmt10c antibody, trmt10c.L antibody, Trmt10c antibody

Background: RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.

Molecular Weight: 47 kDa (MW of target protein)