NOP56 antibody

Catalog No. ABIN633377

Product Details anti-NOP56 Antibody

Target: NOP56 (NOP56 Ribonucleoprotein Homolog (NOP56))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOP56 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: NOL5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK

Application Details

Application Notes: WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOL5A Blocking Peptide, catalog no. 33R-10114, is also available for use as a blocking control in assays to test for specificity of this NOL5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOP56

Target: NOP56 (NOP56 Ribonucleoprotein Homolog (NOP56))

Alternative Name: NOL5A (NOP56 Products)

Synonyms: An16g03090 antibody, AO090005001291 antibody, NOL5A antibody, SCA36 antibody, 2310044F10Rik antibody, Nol5a antibody, nol5a antibody, nucleolar protein 56 antibody, NOP56 ribonucleoprotein antibody, NOP56 ribonucleoprotein homolog antibody, ANI_1_440144 antibody, AOR_1_2236174 antibody, NOP56 antibody, Nop56 antibody, nop56 antibody

Background: Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. NOL5A is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them have not been determined.

Molecular Weight: 66 kDa (MW of target protein)