MRPL24 antibody (N-Term)

Catalog No. ABIN633373

Product Details anti-MRPL24 Antibody

Target: MRPL24 (Mitochondrial Ribosomal Protein L24 (MRPL24))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL24 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPL24 antibody was raised against the N terminal of MRPL24

Purification: Affinity purified

Immunogen: MRPL24 antibody was raised using the N terminal of MRPL24 corresponding to a region with amino acids RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL24 Blocking Peptide, catalog no. 33R-8157, is also available for use as a blocking control in assays to test for specificity of this MRPL24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL24

Target: MRPL24 (Mitochondrial Ribosomal Protein L24 (MRPL24))

Alternative Name: MRPL24 (MRPL24 Products)

Synonyms: L24mt antibody, MRP-L18 antibody, MRP-L24 antibody, CG8849 antibody, Dmel\\CG8849 antibody, L24 antibody, RpL24 antibody, 2010005E08Rik antibody, 2810470K06Rik antibody, 6720473G22Rik antibody, AA407670 antibody, rpl24 antibody, rpl24-A antibody, GB10626 antibody, zgc:92702 antibody, l24mt antibody, mrp-l18 antibody, mrp-l24 antibody, mitochondrial ribosomal protein L24 antibody, mitochondrial ribosomal protein L24 L homeolog antibody, probable 39S ribosomal protein L24, mitochondrial antibody, mitochondrial 54S ribosomal protein YmL24/YmL14 antibody, mitochondrial ribosomal protein subunit L28 (predicted) antibody, Putative mitochondrial ribosomal protein L24 antibody, MRPL24 antibody, mRpL24 antibody, Mrpl24 antibody, mrpl24 antibody, mrpl24.L antibody, LOC408675 antibody, CAALFM_C203950WA antibody

Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. MRPL24 is a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24).

Molecular Weight: 25 kDa (MW of target protein)