DDX25 antibody

Catalog No. ABIN633365

Product Details anti-DDX25 Antibody

Target: DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX25 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DDX25 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX25 Blocking Peptide, catalog no. 33R-9349, is also available for use as a blocking control in assays to test for specificity of this DDX25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX25

Target: DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))

Alternative Name: DDX25 (DDX25 Products)

Synonyms: DDX25 antibody, grth antibody, xcat3 antibody, zd10a antibody, deadsouth antibody, GRTH antibody, AW047046 antibody, DEAD-box helicase 25 antibody, DEAD-box helicase 25 L homeolog antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 25 antibody, DDX25 antibody, ddx25 antibody, ddx25.L antibody, Ddx25 antibody

Background: DDX25 is a member of DEAD box proteins family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molecular Weight: 41 kDa (MW of target protein)