DDX25 antibody
-
- Target See all DDX25 Antibodies
- DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DDX25 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DDX25 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV
- Top Product
- Discover our top product DDX25 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDX25 Blocking Peptide, catalog no. 33R-9349, is also available for use as a blocking control in assays to test for specificity of this DDX25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))
- Alternative Name
- DDX25 (DDX25 Products)
- Background
- DDX25 is a member of DEAD box proteins family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.
- Molecular Weight
- 41 kDa (MW of target protein)
-