DDX42 antibody

Catalog No. ABIN633362

Product Details anti-DDX42 Antibody

Target: DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX42 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DDX42 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX42 Blocking Peptide, catalog no. 33R-7187, is also available for use as a blocking control in assays to test for specificity of this DDX42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX42

Target: DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))

Alternative Name: DDX42 (DDX42 Products)

Synonyms: im:7148194 antibody, si:dkey-15n1.10 antibody, zgc:111815 antibody, DDX42P antibody, RHELP antibody, RNAHP antibody, SF3b125 antibody, 1810047H21Rik antibody, AW319508 antibody, AW556242 antibody, B430002H05Rik antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 42 antibody, DEAD-box helicase 42 antibody, DEAD-box helicase 42 L homeolog antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 antibody, ddx42 antibody, DDX42 antibody, Ddx42 antibody, ddx42.L antibody

Background: DDX42 is a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.

Molecular Weight: 103 kDa (MW of target protein)