DDX42 antibody
-
- Target See all DDX42 Antibodies
- DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DDX42 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DDX42 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM
- Top Product
- Discover our top product DDX42 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDX42 Blocking Peptide, catalog no. 33R-7187, is also available for use as a blocking control in assays to test for specificity of this DDX42 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX42 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))
- Alternative Name
- DDX42 (DDX42 Products)
- Background
- DDX42 is a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.
- Molecular Weight
- 103 kDa (MW of target protein)
-