RBM22 antibody (C-Term)

Catalog No. ABIN633355

Product Details anti-RBM22 Antibody

Target: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM22 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RBM22 antibody was raised against the C terminal of RBM22

Purification: Affinity purified

Immunogen: RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM22 Blocking Peptide, catalog no. 33R-4730, is also available for use as a blocking control in assays to test for specificity of this RBM22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM22

Target: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Alternative Name: RBM22 (RBM22 Products)

Synonyms: Cwc2 antibody, ZC3H16 antibody, fSAP47 antibody, 8430430L24Rik antibody, fb37a01 antibody, zgc:77910 antibody, wu:fb37a01 antibody, wu:fc62e03 antibody, wu:fe05c04 antibody, RBM22 antibody, cg14641 antibody, RNA binding motif protein 22 antibody, RNA binding motif protein 22 S homeolog antibody, RBM22 antibody, Rbm22 antibody, rbm22 antibody, rbm22.S antibody

Background: RBM22 may be involved in pre-mRNA splicing.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus