SRSF11 antibody (C-Term)
-
- Target See all SRSF11 Antibodies
- SRSF11 (serine/arginine-Rich Splicing Factor 11 (SRSF11))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SRSF11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SFRS11 antibody was raised against the C terminal of SFRS11
- Purification
- Affinity purified
- Immunogen
- SFRS11 antibody was raised using the C terminal of SFRS11 corresponding to a region with amino acids KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET
- Top Product
- Discover our top product SRSF11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFRS11 Blocking Peptide, catalog no. 33R-4478, is also available for use as a blocking control in assays to test for specificity of this SFRS11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRSF11 (serine/arginine-Rich Splicing Factor 11 (SRSF11))
- Alternative Name
- SFRS11 (SRSF11 Products)
- Synonyms
- NET2 antibody, SFRS11 antibody, dJ677H15.2 antibody, p54 antibody, 0610009J05Rik antibody, 2610019N13Rik antibody, BF642805 antibody, Sfrs11 antibody, serine and arginine rich splicing factor 11 antibody, serine/arginine-rich splicing factor 11 antibody, SRSF11 antibody, Srsf11 antibody
- Background
- SFRS11 is 54 kDa nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.
- Molecular Weight
- 53 kDa (MW of target protein)
-