CELF4 antibody
-
- Target See all CELF4 Antibodies
- CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CELF4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- BRUNOL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI
- Top Product
- Discover our top product CELF4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BRUNOL4 Blocking Peptide, catalog no. 33R-7218, is also available for use as a blocking control in assays to test for specificity of this BRUNOL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))
- Alternative Name
- BRUNOL4 (CELF4 Products)
- Background
- Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Synaptic Membrane
-