CELF4 antibody

Catalog No. ABIN633349

Product Details anti-CELF4 Antibody

Target: CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CELF4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: BRUNOL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BRUNOL4 Blocking Peptide, catalog no. 33R-7218, is also available for use as a blocking control in assays to test for specificity of this BRUNOL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CELF4

Target: CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))

Alternative Name: BRUNOL4 (CELF4 Products)

Synonyms: brunol4 antibody, zgc:92761 antibody, brunol-4 antibody, BRUNOL-4 antibody, BRUNOL4 antibody, A230070D14Rik antibody, Brul4 antibody, Brunol4 antibody, C130060B05Rik antibody, CUGBP, Elav-like family member 4 antibody, CUGBP, Elav-like family member 4 L homeolog antibody, CUGBP Elav-like family member 4 antibody, celf4 antibody, celf4.L antibody, CELF4 antibody, Celf4 antibody, LOC100732038 antibody

Background: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Synaptic Membrane