CTIF/KIAA0427 antibody (N-Term)

Catalog No. ABIN633348

Product Details anti-CTIF/KIAA0427 Antibody

Target: CTIF/KIAA0427 (CTIF) (CBP80/20-Dependent Translation Initiation Factor (CTIF))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CTIF/KIAA0427 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA0427 antibody was raised against the N terminal of KIAA0427

Purification: Affinity purified

Immunogen: KIAA0427 antibody was raised using the N terminal of KIAA0427 corresponding to a region with amino acids SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0427 Blocking Peptide, catalog no. 33R-8789, is also available for use as a blocking control in assays to test for specificity of this KIAA0427 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0427 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CTIF/KIAA0427

Target: CTIF/KIAA0427 (CTIF) (CBP80/20-Dependent Translation Initiation Factor (CTIF))

Alternative Name: KIAA0427 (CTIF Products)

Synonyms: Gm672 antibody, KIAA0427 antibody, gm672 antibody, kiaa0427 antibody, cap binding complex dependent translation initiation factor antibody, CBP80/20-dependent translation initiation factor antibody, similar to Peroxisomal biogenesis factor 19 (Peroxin-19) (Peroxisomal farnesylated protein) antibody, CTIF antibody, ctif antibody, Ctif antibody, LOC679129 antibody

Background: CTIF is a component of the CBP80/CBP20 translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step that recognises premature termination codons (PTCs) in mRNAs and directs PTC-containing mRNAs toward nonsense-mediated decay.

Molecular Weight: 67 kDa (MW of target protein)