LSM6 antibody

Catalog No. ABIN633347

Product Details anti-LSM6 Antibody

Target: LSM6 (LSM6 Homolog, U6 Small Nuclear RNA Associated (LSM6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LSM6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LSM6 Blocking Peptide, catalog no. 33R-6468, is also available for use as a blocking control in assays to test for specificity of this LSM6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LSM6

Target: LSM6 (LSM6 Homolog, U6 Small Nuclear RNA Associated (LSM6))

Alternative Name: LSM6 (LSM6 Products)

Synonyms: zgc:92379 antibody, YDR378C antibody, 1500031N17Rik antibody, 2410088K19Rik antibody, AI747288 antibody, RGD1561937 antibody, LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated S homeolog antibody, LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated antibody, lsm6.S antibody, lsm6 antibody, LSM6 antibody, Lsm6 antibody

Background: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Molecular Weight: 9 kDa (MW of target protein)