GRSF1 antibody (Middle Region)
-
- Target See all GRSF1 Antibodies
- GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GRSF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GRSF1 antibody was raised against the middle region of GRSF1
- Purification
- Affinity purified
- Immunogen
- GRSF1 antibody was raised using the middle region of GRSF1 corresponding to a region with amino acids IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV
- Top Product
- Discover our top product GRSF1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GRSF1 Blocking Peptide, catalog no. 33R-4139, is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRSF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))
- Alternative Name
- GRSF1 (GRSF1 Products)
- Background
- GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.
- Molecular Weight
- 53 kDa (MW of target protein)
-