HNRNPA1L2 antibody (N-Term)
-
- Target See all HNRNPA1L2 Antibodies
- HNRNPA1L2 (Heterogeneous Nuclear Ribonucleoprotein A1-Like 2 (HNRNPA1L2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPA1L2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- RP11-78 J21.1 antibody was raised against the N terminal of RP11-78 21.1
- Purification
- Affinity purified
- Immunogen
- RP11-78 J21.1 antibody was raised using the N terminal of RP11-78 21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
- Top Product
- Discover our top product HNRNPA1L2 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RP11-78J21.1 Blocking Peptide, catalog no. 33R-6454, is also available for use as a blocking control in assays to test for specificity of this RP11-78J21.1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-70 21.1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPA1L2 (Heterogeneous Nuclear Ribonucleoprotein A1-Like 2 (HNRNPA1L2))
- Abstract
- HNRNPA1L2 Products
- Synonyms
- heterogeneous nuclear ribonucleoprotein A1-like 2 antibody, heterogeneous nuclear ribonucleoprotein A1 antibody, HNRNPA1L2 antibody, LOC785761 antibody
- Background
- The function of RP11-78J21.1 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 35 kDa (MW of target protein)
-