A1CF antibody (N-Term)
-
- Target See all A1CF Antibodies
- A1CF (APOBEC1 Complementation Factor (A1CF))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This A1CF antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- A1 CF antibody was raised against the N terminal of A1 F
- Purification
- Affinity purified
- Immunogen
- A1 CF antibody was raised using the N terminal of A1 F corresponding to a region with amino acids MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA
- Top Product
- Discover our top product A1CF Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
A1CF Blocking Peptide, catalog no. 33R-5962, is also available for use as a blocking control in assays to test for specificity of this A1CF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 F antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- A1CF (APOBEC1 Complementation Factor (A1CF))
- Alternative Name
- A1CF (A1CF Products)
- Background
- Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene.
- Molecular Weight
- 64 kDa (MW of target protein)
-