A1CF antibody (N-Term)

Catalog No. ABIN633338

Product Details anti-A1CF Antibody

Target: A1CF (APOBEC1 Complementation Factor (A1CF))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This A1CF antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: A1 CF antibody was raised against the N terminal of A1 F

Purification: Affinity purified

Immunogen: A1 CF antibody was raised using the N terminal of A1 F corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

A1CF Blocking Peptide, catalog no. 33R-2286, is also available for use as a blocking control in assays to test for specificity of this A1CF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 F antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for A1CF

Target: A1CF (APOBEC1 Complementation Factor (A1CF))

Alternative Name: A1CF (A1CF Products)

Synonyms: ACF antibody, ACF64 antibody, ACF65 antibody, APOBEC1CF antibody, ASP antibody, 1810073H04Rik antibody, Acf antibody, A1cft antibody, Apobec-1 antibody, acf antibody, acf64 antibody, acf65 antibody, apobec1cf antibody, asp antibody, A1CF antibody, APOBEC1 complementation factor antibody, apobec1 complementation factor antibody, APOBEC1 complementation factor L homeolog antibody, A1CF antibody, A1cf antibody, a1cf antibody, a1cf.L antibody

Background: Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. A1CF has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events.

Molecular Weight: 65 kDa (MW of target protein)