HDLBP antibody
-
- Target See all HDLBP Antibodies
- HDLBP (High Density Lipoprotein Binding Protein (HDLBP))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HDLBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV
- Top Product
- Discover our top product HDLBP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HDLBP Blocking Peptide, catalog no. 33R-8017, is also available for use as a blocking control in assays to test for specificity of this HDLBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDLBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HDLBP (High Density Lipoprotein Binding Protein (HDLBP))
- Alternative Name
- HDLBP (HDLBP Products)
- Synonyms
- HBP antibody, PRO2900 antibody, VGL antibody, 1110005P14Rik antibody, AA960365 antibody, AI118566 antibody, D1Ertd101e antibody, HDLBP antibody, vigilin antibody, cb591 antibody, cb811 antibody, hdlbp antibody, wu:fb36d01 antibody, wu:fb94h08 antibody, wu:fc23d06 antibody, wu:fc75h07 antibody, high density lipoprotein binding protein antibody, high density lipoprotein (HDL) binding protein antibody, vigilin antibody, high density lipoprotein binding protein (vigilin) S homeolog antibody, high density lipoprotein binding protein a antibody, HDLBP antibody, Hdlbp antibody, hdlbp.S antibody, hdlbpa antibody
- Background
- HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.
- Molecular Weight
- 141 kDa (MW of target protein)
-