DHX34 antibody

Catalog No. ABIN633327

Product Details anti-DHX34 Antibody

Target: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX34 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX34 Blocking Peptide, catalog no. 33R-9728, is also available for use as a blocking control in assays to test for specificity of this DHX34 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX34

Target: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Alternative Name: DHX34 (DHX34 Products)

Synonyms: DDX34 antibody, HRH1 antibody, 1200013B07Rik antibody, 1810012L18Rik antibody, Ddx34 antibody, mKIAA0134 antibody, DExH-box helicase 34 antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 34 antibody, DEAH-box helicase 34 antibody, DHX34 antibody, dhx34 antibody, Dhx34 antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. It is mapped to the glioma 19q tumor suppressor region and is a tumor suppressor candidate gene.

Molecular Weight: 97 kDa (MW of target protein)