DHX34 antibody
-
- Target See all DHX34 Antibodies
- DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHX34 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD
- Top Product
- Discover our top product DHX34 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHX34 Blocking Peptide, catalog no. 33R-9728, is also available for use as a blocking control in assays to test for specificity of this DHX34 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX34 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))
- Alternative Name
- DHX34 (DHX34 Products)
- Background
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. It is mapped to the glioma 19q tumor suppressor region and is a tumor suppressor candidate gene.
- Molecular Weight
- 97 kDa (MW of target protein)
-