DHX37 antibody
-
- Target See all DHX37 Antibodies
- DHX37 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHX37 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DHX37 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG
- Top Product
- Discover our top product DHX37 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHX37 Blocking Peptide, catalog no. 33R-7211, is also available for use as a blocking control in assays to test for specificity of this DHX37 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX37 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX37 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37))
- Alternative Name
- DHX37 (DHX37 Products)
- Synonyms
- DDBDRAFT_0187437 antibody, DDBDRAFT_0235265 antibody, DDB_0187437 antibody, DDB_0235265 antibody, im:7151586 antibody, wu:fd11d06 antibody, zgc:158802 antibody, DDX37 antibody, Gm1050 antibody, Gm451 antibody, mKIAA1517 antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 37 antibody, DEAD/DEAH box helicase antibody, DEAH-box helicase 37 antibody, DEAH-box helicase 37 L homeolog antibody, DHX37 antibody, dhx37 antibody, dhx37.L antibody, Dhx37 antibody
- Background
- DHX37 is a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.
- Molecular Weight
- 129 kDa (MW of target protein)
-