MIF4GD antibody (N-Term)
-
- Target See all MIF4GD Antibodies
- MIF4GD (MIF4G Domain Containing (MIF4GD))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MIF4GD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MIF4 GD antibody was raised against the N terminal of MIF4 D
- Purification
- Affinity purified
- Immunogen
- MIF4 GD antibody was raised using the N terminal of MIF4 D corresponding to a region with amino acids MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR
- Top Product
- Discover our top product MIF4GD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MIF4GD Blocking Peptide, catalog no. 33R-6024, is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIF0 D antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MIF4GD (MIF4G Domain Containing (MIF4GD))
- Alternative Name
- MIF4GD (MIF4GD Products)
- Synonyms
- AD023 antibody, MIFD antibody, SLIP1 antibody, 1110014L05Rik antibody, 2310075G12Rik antibody, RGD1309685 antibody, MIF4GD antibody, zgc:64152 antibody, zgc:110826 antibody, ad023 antibody, mif4gd antibody, mif4gd-a antibody, mif4gd-b antibody, mifd antibody, slip1 antibody, MIF4G domain containing antibody, MIF4G domain containing a antibody, MIF4G domain containing b antibody, MIF4G domain containing L homeolog antibody, MIF4G domain containing S homeolog antibody, MIF4GD antibody, Mif4gd antibody, mif4gda antibody, mif4gdb antibody, mif4gd.L antibody, mif4gd.S antibody
- Background
- MIF4GD is a protein which contains an MIF4G domain.
- Molecular Weight
- 29 kDa (MW of target protein)
-