MOV10L1 antibody

Catalog No. ABIN633316

Product Details anti-MOV10L1 Antibody

Target: MOV10L1 (Mov10l1, Moloney Leukemia Virus 10-Like 1 (MOV10L1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MOV10L1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MOV10 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MOV10L1 Blocking Peptide, catalog no. 33R-5253, is also available for use as a blocking control in assays to test for specificity of this MOV10L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOV10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MOV10L1

Target: MOV10L1 (Mov10l1, Moloney Leukemia Virus 10-Like 1 (MOV10L1))

Alternative Name: MOV10L1 (MOV10L1 Products)

Synonyms: CHAMP antibody, Csm antibody, DJ402G11.8 antibody, Mov10 RISC complex RNA helicase like 1 antibody, Moloney leukemia virus 10-like 1 antibody, MOV10L1 antibody, mov10l1 antibody, Mov10l1 antibody

Background: This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 135 kDa (MW of target protein)