RBMS2 antibody (N-Term)

Catalog No. ABIN633313

Product Details anti-RBMS2 Antibody

Target: RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2 (RBMS2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBMS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBMS2 antibody was raised against the N terminal of RBMS2

Purification: Affinity purified

Immunogen: RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBMS2 Blocking Peptide, catalog no. 33R-6197, is also available for use as a blocking control in assays to test for specificity of this RBMS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBMS2

Target: RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2 (RBMS2))

Alternative Name: RBMS2 (RBMS2 Products)

Synonyms: SCR3 antibody, 2610315E04Rik antibody, Scr3 antibody, zgc:100836 antibody, RBMS2 antibody, RNA binding motif single stranded interacting protein 2 antibody, RNA binding motif, single stranded interacting protein 2 antibody, RNA binding motif, single stranded interacting protein 2b antibody, RBMS2 antibody, Rbms2 antibody, rbms2b antibody

Background: RBMS2 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding.

Molecular Weight: 44 kDa (MW of target protein)