EIF4H antibody (C-Term)

Catalog No. ABIN633301

Product Details anti-EIF4H Antibody

Target: EIF4H (Eukaryotic Translation Initiation Factor 4H (EIF4H))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF4H antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF4 H antibody was raised against the C terminal of EIF4

Purification: Affinity purified

Immunogen: EIF4 H antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF4H Blocking Peptide, catalog no. 33R-9032, is also available for use as a blocking control in assays to test for specificity of this EIF4H antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF4H

Target: EIF4H (Eukaryotic Translation Initiation Factor 4H (EIF4H))

Alternative Name: EIF4H (EIF4H Products)

Background: EIF4H is one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome