EIF4H antibody (C-Term)

Catalog No. ABIN633301

Product Details anti-EIF4H Antibody

Target: EIF4H (Eukaryotic Translation Initiation Factor 4H (EIF4H))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF4H antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF4 H antibody was raised against the C terminal of EIF4

Purification: Affinity purified

Immunogen: EIF4 H antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF4H Blocking Peptide, catalog no. 33R-9032, is also available for use as a blocking control in assays to test for specificity of this EIF4H antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF4H

Target: EIF4H (Eukaryotic Translation Initiation Factor 4H (EIF4H))

Alternative Name: EIF4H (EIF4H Products)

Synonyms: wscr1 antibody, wbscr1 antibody, WBSCR1 antibody, Wbscr1 antibody, WSCR1 antibody, eIF-4H antibody, AU018978 antibody, D5Ertd355e antibody, E430026L18Rik antibody, Ef4h antibody, Wscr1 antibody, mKIAA0038 antibody, zgc:77282 antibody, eukaryotic translation initiation factor 4H antibody, eukaryotic translation initiation factor 4H L homeolog antibody, eukaryotic translation initiation factor 4h antibody, transaltion initiation factor antibody, Eukaryotic translation initiation factor 4H antibody, eif4h antibody, eif4h.L antibody, EIF4H antibody, Eif4h antibody, LOC733087 antibody, SJAG_03433 antibody, MGYG_07815 antibody, Tsp_06589 antibody, if4h antibody

Background: EIF4H is one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome