RBM45 antibody (Middle Region)

Catalog No. ABIN633300

Product Details anti-RBM45 Antibody

Target: RBM45 (RNA Binding Motif Protein 45 (RBM45))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM45 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM45 antibody was raised against the middle region of RBM45

Purification: Affinity purified

Immunogen: RBM45 antibody was raised using the middle region of RBM45 corresponding to a region with amino acids MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM45 Blocking Peptide, catalog no. 33R-6375, is also available for use as a blocking control in assays to test for specificity of this RBM45 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM45

Target: RBM45 (RNA Binding Motif Protein 45 (RBM45))

Alternative Name: RBM45 (RBM45 Products)

Synonyms: DRB1 antibody, Drb1 antibody, Drbp1 antibody, G430095G15Rik antibody, drb1 antibody, drbp1 antibody, MGC53228 antibody, RBM45 antibody, si:ch211-222f23.2 antibody, DKFZp459H0661 antibody, RNA binding motif protein 45 antibody, RNA binding motif protein 45 S homeolog antibody, RBM45 antibody, Rbm45 antibody, rbm45.S antibody, rbm45 antibody

Background: RBM45 is a RNA-binding protein with binding specificity for poly(C). It May play an important role in neural development. RBM45 contains 3 RRM (RNA recognition motif) domains.

Molecular Weight: 53 kDa (MW of target protein)