SRSF3 antibody (N-Term)
-
- Target See all SRSF3 Antibodies
- SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SRSF3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SFRS3 antibody was raised against the N terminal of SFRS3
- Purification
- Affinity purified
- Immunogen
- SFRS3 antibody was raised using the N terminal of SFRS3 corresponding to a region with amino acids SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS
- Top Product
- Discover our top product SRSF3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFRS3 Blocking Peptide, catalog no. 33R-8935, is also available for use as a blocking control in assays to test for specificity of this SFRS3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))
- Alternative Name
- SFRS3 (SRSF3 Products)
- Synonyms
- SFRS3 antibody, SRp20 antibody, AL024116 antibody, Sfrs3 antibody, X16 antibody, sfrs3 antibody, srp20 antibody, SRP20 antibody, si:zc263a23.9 antibody, zgc:86626 antibody, serine and arginine rich splicing factor 3 antibody, serine/arginine-rich splicing factor 3 antibody, serine/arginine-rich splicing factor 3 S homeolog antibody, serine/arginine-rich splicing factor 3a antibody, SRSF3 antibody, Srsf3 antibody, srsf3.S antibody, srsf3a antibody
- Background
- SFRS3 belongs to the splicing factor SR family. It contains 1 RRM (RNA recognition motif) domain. It may be involved in RNA processing in relation with cellular proliferation and/or maturation.
- Molecular Weight
- 19 kDa (MW of target protein)
-