SNRPB antibody (N-Term)

Catalog No. ABIN633272

Product Details anti-SNRPB Antibody

Target: SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1 (SNRPB))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SNRPB antibody was raised against the N terminal of SNRPB

Purification: Affinity purified

Immunogen: SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPB Blocking Peptide, catalog no. 33R-2018, is also available for use as a blocking control in assays to test for specificity of this SNRPB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPB

Target: SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1 (SNRPB))

Alternative Name: SNRPB (SNRPB Products)

Background: SNRPB is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization