SNRPB antibody (N-Term)

Catalog No. ABIN633272

Product Details anti-SNRPB Antibody

Target: SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1 (SNRPB))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SNRPB antibody was raised against the N terminal of SNRPB

Purification: Affinity purified

Immunogen: SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPB Blocking Peptide, catalog no. 33R-2018, is also available for use as a blocking control in assays to test for specificity of this SNRPB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPB

Target: SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1 (SNRPB))

Alternative Name: SNRPB (SNRPB Products)

Synonyms: AL024368 antibody, AU018828 antibody, SM-B antibody, SM11 antibody, SMB antibody, SNRNP-B antibody, SNRB' antibody, SNRPB' antibody, Snrpn antibody, zgc:77315 antibody, cod antibody, sm-b/b' antibody, smb/b' antibody, smb/smb' antibody, snrnp-b antibody, snrpb1 antibody, snurf antibody, DDBDRAFT_0206555 antibody, DDBDRAFT_0233178 antibody, DDB_0206555 antibody, DDB_0233178 antibody, COD antibody, SNRPB1 antibody, Sm-B/B' antibody, SmB/B' antibody, SmB/SmB' antibody, snRNP-B antibody, Sm-B' antibody, SmB' antibody, snRNP-B' antibody, snRPB' antibody, small nuclear ribonucleoprotein B antibody, small nuclear ribonucleoprotein polypeptides B and B1 antibody, small nuclear ribonucleoprotein polypeptide-like antibody, small nuclear ribonucleoprotein polypeptides B and B1 L homeolog antibody, mRNA splicing factor antibody, LSM domain-containing protein antibody, Snrpb antibody, SNRPL antibody, snrpb antibody, SNRPB antibody, snrpb.L antibody, snrpB antibody

Background: SNRPB is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization