EXOSC3 antibody (Middle Region)

Catalog No. ABIN633267

Product Details anti-EXOSC3 Antibody

Target: EXOSC3 (Exosome Component 3 (EXOSC3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOSC3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: EXOSC3 antibody was raised against the middle region of EXOSC3

Purification: Affinity purified

Immunogen: EXOSC3 antibody was raised using the middle region of EXOSC3 corresponding to a region with amino acids TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOSC3 Blocking Peptide, catalog no. 33R-9133, is also available for use as a blocking control in assays to test for specificity of this EXOSC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOSC3

Target: EXOSC3 (Exosome Component 3 (EXOSC3))

Alternative Name: EXOSC3 (EXOSC3 Products)

Synonyms: PCH1B antibody, RP11-3J10.8 antibody, RRP40 antibody, Rrp40p antibody, bA3J10.7 antibody, hRrp-40 antibody, p10 antibody, 2310005D06Rik antibody, AI593501 antibody, Rrp40 antibody, im:7140537 antibody, zgc:112345 antibody, exosome component 3 antibody, exosome component 3 L homeolog antibody, EXOSC3 antibody, exosc3.L antibody, Exosc3 antibody, exosc3 antibody

Background: EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, SARS-CoV-2 Protein Interactome