SLIRP antibody (N-Term)

Catalog No. ABIN633258

Product Details anti-SLIRP Antibody

Target: SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLIRP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C14 ORF156 antibody was raised against the N terminal Of C14 rf156

Purification: Affinity purified

Immunogen: C14 ORF156 antibody was raised using the N terminal Of C14 rf156 corresponding to a region with amino acids PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF156 Blocking Peptide, catalog no. 33R-7071, is also available for use as a blocking control in assays to test for specificity of this C14ORF156 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF156 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLIRP

Target: SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))

Alternative Name: C14ORF156 (SLIRP Products)

Synonyms: C14orf156 antibody, SLIRP antibody, DKFZp468C196 antibody, DC50 antibody, PD04872 antibody, 1810035L17Rik antibody, C10H14orf156 antibody, SRA stem-loop interacting RNA binding protein antibody, Slirp antibody, C14orf156 antibody, SLIRP antibody

Background: As a RNA-binding protein, C14orf156 acts as a nuclear receptor corepressor. It probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. C14orf156 binds the STR7 loop of SRA RNA. It is also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.

Molecular Weight: 12 kDa (MW of target protein)