SLIRP antibody (N-Term)
-
- Target See all SLIRP Antibodies
- SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLIRP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C14 ORF156 antibody was raised against the N terminal Of C14 rf156
- Purification
- Affinity purified
- Immunogen
- C14 ORF156 antibody was raised using the N terminal Of C14 rf156 corresponding to a region with amino acids PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ
- Top Product
- Discover our top product SLIRP Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C14ORF156 Blocking Peptide, catalog no. 33R-7071, is also available for use as a blocking control in assays to test for specificity of this C14ORF156 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF156 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))
- Alternative Name
- C14ORF156 (SLIRP Products)
- Background
- As a RNA-binding protein, C14orf156 acts as a nuclear receptor corepressor. It probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. C14orf156 binds the STR7 loop of SRA RNA. It is also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.
- Molecular Weight
- 12 kDa (MW of target protein)
-