RDBP antibody (N-Term)
-
- Target See all RDBP Antibodies
- RDBP (RD RNA Binding Protein (RDBP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RDBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RDBP antibody was raised against the N terminal of RDBP
- Purification
- Affinity purified
- Immunogen
- RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS
- Top Product
- Discover our top product RDBP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RDBP Blocking Peptide, catalog no. 33R-5514, is also available for use as a blocking control in assays to test for specificity of this RDBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RDBP (RD RNA Binding Protein (RDBP))
- Alternative Name
- RDBP (RDBP Products)
- Background
- RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins, however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D).
- Molecular Weight
- 43 kDa (MW of target protein)
-