RAE1 antibody
-
- Target See all RAE1 Antibodies
- RAE1 (RAE1 RNA Export 1 Homolog (S. Pombe) (RAE1))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAE1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- RAE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE
- Top Product
- Discover our top product RAE1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAE1 Blocking Peptide, catalog no. 33R-2670, is also available for use as a blocking control in assays to test for specificity of this RAE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAE1 (RAE1 RNA Export 1 Homolog (S. Pombe) (RAE1))
- Alternative Name
- RAE1 (RAE1 Products)
- Synonyms
- gle2 antibody, mig14 antibody, mnrp41 antibody, mrnp41 antibody, MRNP41 antibody, zgc:56449 antibody, zgc:77723 antibody, 3230401I12Rik antibody, 41 antibody, D2Ertd342e antibody, MNRP antibody, MNRP41 antibody, MIG14 antibody, Mnrp41 antibody, dJ481F12.3 antibody, dJ800J21.1 antibody, ribonucleic acid export 1 antibody, RAE1 RNA export 1 homolog antibody, ribonucleic acid export 1 L homeolog antibody, rae1 antibody, LOC664096 antibody, RAE1 antibody, rae1.L antibody, Rae1 antibody
- Background
- RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-