PNPT1 antibody (Middle Region)
-
- Target See all PNPT1 Antibodies
- PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PNPT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PNPT1 antibody was raised against the middle region of PNPT1
- Purification
- Affinity purified
- Immunogen
- PNPT1 antibody was raised using the middle region of PNPT1 corresponding to a region with amino acids CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED
- Top Product
- Discover our top product PNPT1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PNPT1 Blocking Peptide, catalog no. 33R-1698, is also available for use as a blocking control in assays to test for specificity of this PNPT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))
- Alternative Name
- PNPT1 (PNPT1 Products)
- Synonyms
- COXPD13 antibody, DFNB70 antibody, OLD35 antibody, PNPASE antibody, old-35 antibody, 1200003F12Rik antibody, Old35 antibody, PNPase antibody, Pnptl1 antibody, polyribonucleotide nucleotidyltransferase 1, mitochondrial antibody, polyribonucleotide nucleotidyltransferase 1 antibody, CpipJ_CPIJ005886 antibody, PNPT1 antibody, Pnpt1 antibody
- Background
- PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation.
- Molecular Weight
- 86 kDa (MW of target protein)
-