XPOT antibody
-
- Target See all XPOT Antibodies
- XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This XPOT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- XPOT antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL
- Top Product
- Discover our top product XPOT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
XPOT Blocking Peptide, catalog no. 33R-9364, is also available for use as a blocking control in assays to test for specificity of this XPOT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPOT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))
- Alternative Name
- XPOT (XPOT Products)
- Synonyms
- 110.t00019 antibody, XPO3 antibody, Exportin-T antibody, si:ch211-286m4.4 antibody, exportin-T antibody, 1110004L07Rik antibody, 3110065H13Rik antibody, AI452076 antibody, C79645 antibody, EXPORTIN-T antibody, exportin T antibody, exportin for tRNA antibody, exportin, tRNA (nuclear export receptor for tRNAs) antibody, EHI_029040 antibody, XPOT antibody, Xpot antibody, xpot antibody
- Background
- XPOT belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN.
- Molecular Weight
- 110 kDa (MW of target protein)
-