NXF1 antibody (N-Term)
-
- Target See all NXF1 Antibodies
- NXF1 (Nuclear RNA Export Factor 1 (NXF1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NXF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NXF1 antibody was raised against the N terminal of NXF1
- Purification
- Affinity purified
- Immunogen
- NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG
- Top Product
- Discover our top product NXF1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NXF1 Blocking Peptide, catalog no. 33R-8098, is also available for use as a blocking control in assays to test for specificity of this NXF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NXF1 (Nuclear RNA Export Factor 1 (NXF1))
- Alternative Name
- NXF1 (NXF1 Products)
- Synonyms
- im:7156527 antibody, wu:fc12d06 antibody, MGC82224 antibody, NXF1 antibody, tap antibody, mex67 antibody, MEX67 antibody, TAP antibody, Mex67 antibody, Mvb1 antibody, Tap antibody, Mex67h antibody, nuclear RNA export factor 1 antibody, nuclear RNA export factor 1 S homeolog antibody, Nuclear RNA export factor 1 antibody, nxf1 antibody, nxf1.S antibody, NXF1 antibody, LOC100113601 antibody, Tsp_03999 antibody, Nxf1 antibody, nxf-1 antibody
- Background
- NXF1 is one member of a family of nuclear RNA export factor. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF1 shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. NXF1 overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.
- Molecular Weight
- 68 kDa (MW of target protein)
-