HNRNPR antibody (N-Term)
-
- Target See all HNRNPR Antibodies
- HNRNPR (Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HNRNPR antibody was raised against the N terminal of HNRNPR
- Purification
- Affinity purified
- Immunogen
- HNRNPR antibody was raised using the N terminal of HNRNPR corresponding to a region with amino acids ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ
- Top Product
- Discover our top product HNRNPR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRNPR Blocking Peptide, catalog no. 33R-1408, is also available for use as a blocking control in assays to test for specificity of this HNRNPR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPR (Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR))
- Alternative Name
- HNRNPR (HNRNPR Products)
- Background
- HNRNPR belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.
- Molecular Weight
- 71 kDa (MW of target protein)
-