HNRNPK antibody (N-Term)

Catalog No. ABIN633224

Product Details anti-HNRNPK Antibody

Target: HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPK antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: HNRPK antibody was raised against the N terminal of HNRPK

Purification: Affinity purified

Immunogen: HNRPK antibody was raised using the N terminal of HNRPK corresponding to a region with amino acids NTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKG

Application Details

Application Notes: WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPK Blocking Peptide, catalog no. 33R-6896, is also available for use as a blocking control in assays to test for specificity of this HNRPK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPK

Target: HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))

Alternative Name: HNRPK (HNRNPK Products)

Synonyms: CSBP antibody, HNRPK antibody, TUNP antibody, Csbp antibody, Hnrpk antibody, hnrpk antibody, MGC75642 antibody, wu:fb37h02 antibody, wu:fi34c04 antibody, zgc:66162 antibody, KBBP antibody, NOVA antibody, heterogeneous nuclear ribonucleoprotein K antibody, heterogeneous nuclear ribonucleoprotein K S homeolog antibody, heterogeneous nuclear ribonucleoprotein k antibody, HNRNPK antibody, Hnrnpk antibody, hnrnpk.S antibody, hnrnpk antibody, LOC5565718 antibody, CpipJ_CPIJ000130 antibody, NGK_p0004 antibody

Background: HNRPK belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). The hnRNP proteins have distinct nucleic acid binding properties. HNRPK is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference, it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Multiple alternatively spliced transcript variants have been described for this gene but only three variants have been fully described.

Molecular Weight: 51 kDa (MW of target protein)