SLBP antibody
-
- Target See all SLBP Antibodies
- SLBP (Stem-Loop Binding Protein (SLBP))
-
Reactivity
- Human, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK
- Top Product
- Discover our top product SLBP Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLBP Blocking Peptide, catalog no. 33R-4084, is also available for use as a blocking control in assays to test for specificity of this SLBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLBP (Stem-Loop Binding Protein (SLBP))
- Alternative Name
- SLBP (SLBP Products)
- Background
- SLBP binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.
- Molecular Weight
- 30 kDa (MW of target protein)
-