SLBP antibody

Catalog No. ABIN633212

Product Details anti-SLBP Antibody

Target: SLBP (Stem-Loop Binding Protein (SLBP))

Reactivity: Human, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLBP antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLBP Blocking Peptide, catalog no. 33R-4084, is also available for use as a blocking control in assays to test for specificity of this SLBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLBP

Target: SLBP (Stem-Loop Binding Protein (SLBP))

Alternative Name: SLBP (SLBP Products)

Synonyms: CG11886 antibody, Dmel\\CG11886 antibody, SLBP antibody, dSLBP antibody, dSLPB antibody, slbp antibody, cb157 antibody, sb:cb157 antibody, si:dkey-102m7.2 antibody, GB13630 antibody, HBP antibody, slbp1 antibody, xslbp antibody, stem-loop binding protein antibody, Stem-loop binding protein antibody, histone RNA hairpin-binding protein antibody, stem-loop binding protein L homeolog antibody, Slbp antibody, slbp antibody, SLBP antibody, LOC726745 antibody, EHI_178590 antibody, CpipJ_CPIJ008644 antibody, slbp.L antibody

Background: SLBP binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.

Molecular Weight: 30 kDa (MW of target protein)