RDBP antibody (N-Term)

Catalog No. ABIN633203

Product Details anti-RDBP Antibody

Target: RDBP (RD RNA Binding Protein (RDBP))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RDBP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RDBP antibody was raised against the N terminal of RDBP

Purification: Affinity purified

Immunogen: RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RDBP Blocking Peptide, catalog no. 33R-7738, is also available for use as a blocking control in assays to test for specificity of this RDBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RDBP

Target: RDBP (RD RNA Binding Protein (RDBP))

Alternative Name: RDBP (RDBP Products)

Synonyms: CG5994 antibody, Dmel\\CG5994 antibody, NELF antibody, NELF-E antibody, Nelf-e antibody, anon-66Da antibody, cg5994 antibody, dNelf-E antibody, D6S45 antibody, RD antibody, RDBP antibody, RDP antibody, Rd antibody, Rdbp antibody, D17H6S45 antibody, Negative elongation factor E antibody, negative elongation factor complex member E antibody, negative elongation factor complex member E, Rdbp antibody, Nelf-E antibody, NELFE antibody, Nelfe antibody

Background: RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins, however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation.

Molecular Weight: 43 kDa (MW of target protein)