CPSF4 antibody (C-Term)

Catalog No. ABIN633192

Product Details anti-CPSF4 Antibody

Target: CPSF4 (Cleavage and Polyadenylation Specific Factor 4, 30kDa (CPSF4))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPSF4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CPSF4 antibody was raised against the C terminal of CPSF4

Purification: Affinity purified

Immunogen: CPSF4 antibody was raised using the C terminal of CPSF4 corresponding to a region with amino acids SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPSF4 Blocking Peptide, catalog no. 33R-8599, is also available for use as a blocking control in assays to test for specificity of this CPSF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPSF4

Target: CPSF4 (Cleavage and Polyadenylation Specific Factor 4, 30kDa (CPSF4))

Alternative Name: CPSF4 (CPSF4 Products)

Synonyms: cpsf30 antibody, nar antibody, neb1 antibody, 30kDa antibody, C79664 antibody, CPSF30 antibody, NAR antibody, NEB1 antibody, cleavage and polyadenylation specific factor 4 antibody, cleavage and polyadenylation specific factor 4, 30kDa antibody, cleavage and polyadenylation specific factor 4 S homeolog antibody, CPSF4 antibody, Cpsf4 antibody, LOC733099 antibody, LOC100360200 antibody, cpsf4.S antibody, cpsf4 antibody

Background: Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30 kDa subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs.

Molecular Weight: 24 kDa (MW of target protein)