NBEAL1 antibody (N-Term)
-
- Target See all NBEAL1 products
- NBEAL1 (Neurobeachin-Like 1 (NBEAL1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NBEAL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NBEAL1 antibody was raised against the N terminal of NBEAL1
- Purification
- Affinity purified
- Immunogen
- NBEAL1 antibody was raised using the N terminal of NBEAL1 corresponding to a region with amino acids KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NBEAL1 Blocking Peptide, catalog no. 33R-4298, is also available for use as a blocking control in assays to test for specificity of this NBEAL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NBEAL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NBEAL1 (Neurobeachin-Like 1 (NBEAL1))
- Alternative Name
- NBEAL1 (NBEAL1 Products)
- Background
- NBEAL1 belongs to the WD repeat neurobeachin family. It contains 1 BEACH domain and 2 WD repeats. NBEAL1 is highly expressed in brain, kidney, prostate and testis and weakly expressed in ovary, small intestine, colon and peripheral blood leukocytes. It may be correlative to several tumors, such as ovary serous adenocarcinoma and metastasis mammary gland carcinoma breast.
- Molecular Weight
- 153 kDa (MW of target protein)
-