PURB antibody (N-Term)

Catalog No. ABIN633184

Product Details anti-PURB Antibody

Target: PURB (Purine-Rich Element Binding Protein B (PURB))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PURB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PURB antibody was raised against the N terminal of PURB

Purification: Affinity purified

Immunogen: PURB antibody was raised using the N terminal of PURB corresponding to a region with amino acids MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PURB Blocking Peptide, catalog no. 33R-5621, is also available for use as a blocking control in assays to test for specificity of this PURB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PURB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PURB

Target: PURB (Purine-Rich Element Binding Protein B (PURB))

Alternative Name: PURB (PURB Products)

Synonyms: 2310015K15Rik antibody, AA114818 antibody, Cager-2 antibody, D11Bwg0414e antibody, pur-beta antibody, purb antibody, zgc:65916 antibody, purb-b antibody, purbeta antibody, PURBETA antibody, si:dkey-202n14.1 antibody, purine rich element binding protein B antibody, purine-rich element binding protein Bb antibody, purine-rich element binding protein B L homeolog antibody, purine-rich element binding protein Ba antibody, Purb antibody, purbb antibody, purb.L antibody, PURB antibody, purba antibody

Background: This gene product is a sequence-specific, single-stranded DNA-binding protein.

Molecular Weight: 33 kDa (MW of target protein)