PLXDC1 antibody (N-Term)

Catalog No. ABIN633181

Product Details anti-PLXDC1 Antibody

Target: PLXDC1 (Plexin Domain Containing 1 (PLXDC1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLXDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLXDC1 antibody was raised against the N terminal of PLXDC1

Purification: Affinity purified

Immunogen: PLXDC1 antibody was raised using the N terminal of PLXDC1 corresponding to a region with amino acids MDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLXDC1 Blocking Peptide, catalog no. 33R-5878, is also available for use as a blocking control in assays to test for specificity of this PLXDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLXDC1

Target: PLXDC1 (Plexin Domain Containing 1 (PLXDC1))

Alternative Name: PLXDC1 (PLXDC1 Products)

Synonyms: PLXDC1 antibody, TEM3 antibody, TEM7 antibody, 2410003I07Rik antibody, AI848450 antibody, Tem7 antibody, Arl12 antibody, plexin domain containing 1 antibody, PLXDC1 antibody, Plxdc1 antibody

Background: PLXDC1 (TEM7) may play significant role in proliferation and maintenance of neovascular endothelial cells in fibrovascular membranes. TEM7 may be molecular target for new diagnostic and therapeutic strategies for proliferative diabetic retinopathy. The expression level of TEM7 closely parallels histology-based prognostication of osteogenic sarcoma metastasis and, therefore, it is a therapeutic target.

Molecular Weight: 54 kDa (MW of target protein)