TMPRSS6 antibody (N-Term)
-
- Target See all TMPRSS6 Antibodies
- TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMPRSS6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMPRSS6 antibody was raised against the N terminal of TMPRSS6
- Purification
- Affinity purified
- Immunogen
- TMPRSS6 antibody was raised using the N terminal of TMPRSS6 corresponding to a region with amino acids LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
- Top Product
- Discover our top product TMPRSS6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMPRSS6 Blocking Peptide, catalog no. 33R-5200, is also available for use as a blocking control in assays to test for specificity of this TMPRSS6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))
- Alternative Name
- TMPRSS6 (TMPRSS6 Products)
- Synonyms
- IRIDA antibody, 1300008A22Rik antibody, transmembrane protease, serine 6 antibody, transmembrane serine protease 6 antibody, Tmprss6 antibody, TMPRSS6 antibody
- Background
- TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.
- Molecular Weight
- 90 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-