NAA15 antibody (N-Term)

Catalog No. ABIN633172

Product Details anti-NAA15 Antibody

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAA15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NARG1 antibody was raised against the N terminal of NARG1

Purification: Affinity purified

Immunogen: NARG1 antibody was raised using the N terminal of NARG1 corresponding to a region with amino acids LRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NARG1 Blocking Peptide, catalog no. 33R-5374, is also available for use as a blocking control in assays to test for specificity of this NARG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAA15

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Alternative Name: NARG1 (NAA15 Products)

Synonyms: Ga19 antibody, NARG1 antibody, NATH antibody, TBDN100 antibody, 5730450D16Rik antibody, 6330400I15 antibody, ASTBDN antibody, Narg1 antibody, Tbdn-1 antibody, mNAT1 antibody, narg1l antibody, N(alpha)-acetyltransferase 15, NatA auxiliary subunit antibody, N(alpha)-acetyltransferase 15, NatA auxiliary subunit S homeolog antibody, NAA15 antibody, Naa15 antibody, naa15.S antibody

Background: The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.

Molecular Weight: 101 kDa (MW of target protein)